General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "R7TIR0",
        "id": "R7TIR0_CAPTE",
        "source_organism": {
            "taxId": "283909",
            "scientificName": "Capitella teleta",
            "fullName": "Capitella teleta (Polychaete worm)"
        },
        "name": "Ubiquitin carboxyl-terminal hydrolase",
        "description": [
            "Ubiquitin-protein hydrolase is involved both in the processing of ubiquitin precursors and of ubiquitinated proteins. This enzyme is a thiol protease that recognizes and hydrolyzes a peptide bond at the C-terminal glycine of ubiquitin"
        ],
        "length": 222,
        "sequence": "MTSRWLPLESNPEVMNKYVRALGMPSTFEFVDVWGLDFELLLMVPRPVTAVMLLYPLTDKCESQPLGSEAPGDGVYFMKQTIGNACGTIALIHALCNNKEKLGFDPSKHLSKFLGDTEAMSPEERGKHLEEDSAFGVAHEESAQEGQTKAPSRDDKVDLHFIAFVEKDGGLYELDGRKNAPIRHGDTTADNLLEDAAKVVKKFMARDPDNVNFTVVALAKAG",
        "proteome": "UP000014760",
        "gene": "CAPTEDRAFT_181658",
        "go_terms": [
            {
                "identifier": "GO:0004843",
                "name": "cysteine-type deubiquitinase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006511",
                "name": "ubiquitin-dependent protein catabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "00741e6912966d36a4bd289a3c931dab5ea58149",
        "counters": {
            "domain_architectures": 9993,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "profile": 1,
                "pfam": 1,
                "cdd": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 9993
        }
    }
}