GET /api/protein/UniProt/R7SLC5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "R7SLC5",
        "id": "R7SLC5_DICSQ",
        "source_organism": {
            "taxId": "732165",
            "scientificName": "Dichomitus squalens (strain LYAD-421)",
            "fullName": "Dichomitus squalens (strain LYAD-421) (Western red white-rot fungus)"
        },
        "name": "Transcription and mRNA export factor SUS1",
        "description": [
            "Involved in mRNA export coupled transcription activation by association with both the TREX-2 and the SAGA complexes. At the promoters, SAGA is required for recruitment of the basal transcription machinery. It influences RNA polymerase II transcriptional activity through different activities such as TBP interaction and promoter selectivity, interaction with transcription activators, and chromatin modification through histone acetylation and deubiquitination. Within the SAGA complex, participates to a subcomplex required for deubiquitination of H2B and for the maintenance of steady-state H3 methylation levels. The TREX-2 complex functions in docking export-competent ribonucleoprotein particles (mRNPs) to the nuclear entrance of the nuclear pore complex (nuclear basket). TREX-2 participates in mRNA export and accurate chromatin positioning in the nucleus by tethering genes to the nuclear periphery. May also be involved in cytoplasmic mRNA decay by interaction with components of P-bodies"
        ],
        "length": 104,
        "sequence": "MPPAHKDGRAAALYGPLRRRMIENGDWDRICSRLARELNESGWIDRFKDRSKEMARSAEGNGGVSVDSLLAELLPQAEEEIPVNTRQEIVSVIRKLLERQIEFT",
        "proteome": null,
        "gene": "SUS1",
        "go_terms": [
            {
                "identifier": "GO:0003713",
                "name": "transcription coactivator activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006406",
                "name": "mRNA export from nucleus",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0045893",
                "name": "positive regulation of DNA-templated transcription",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0000124",
                "name": "SAGA complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ba9455d725df3ff238858c99315bda05780bc904",
        "counters": {
            "domain_architectures": 3443,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "hamap": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 3443
        }
    }
}