General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "R7PWX0",
        "id": "R7PWX0_METSM",
        "source_organism": {
            "taxId": "1263088",
            "scientificName": "Methanobrevibacter smithii CAG:186",
            "fullName": "Methanobrevibacter smithii CAG:186"
        },
        "name": "Ribosome biogenesis protein Nop10",
        "description": [
            "Involved in ribosome biogenesis; more specifically in 18S rRNA pseudouridylation and in cleavage of pre-rRNA"
        ],
        "length": 58,
        "sequence": "MNMKMNKCPDCKIYTMEDACPQCGGELKVIYPPKFSIEDKYGKYRRILKKEAMNKKDD",
        "proteome": null,
        "gene": "nop10",
        "go_terms": [
            {
                "identifier": "GO:0030515",
                "name": "snoRNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0001522",
                "name": "pseudouridine synthesis",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0042254",
                "name": "ribosome biogenesis",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "0a180c62c510bf6af2d01f8a4eead65aa45cd131",
        "counters": {
            "domain_architectures": 3779,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "ncbifam": 1,
                "hamap": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 3779
        }
    }
}