General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "R7PSB5",
        "id": "R7PSB5_METSM",
        "source_organism": {
            "taxId": "1263088",
            "scientificName": "Methanobrevibacter smithii CAG:186",
            "fullName": "Methanobrevibacter smithii CAG:186"
        },
        "name": "S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase",
        "description": [
            "Component of the wyosine derivatives biosynthesis pathway that catalyzes the condensation of N-methylguanine with 2 carbon atoms from pyruvate to form the tricyclic 4-demethylwyosine (imG-14) on guanosine-37 of tRNA(Phe)"
        ],
        "length": 304,
        "sequence": "MSLNKKQVEKLESSGYRFVGSHNHAAAKICHWTKQSILDKGVCYKEKFYGIESHRCLQMAPAVPNCQQKCEFCWRDLSYTQTQWEGEYDDPKTIIDEAVKAQNNLLCGFFGNDKANKEKLEESKTPTNAAISLAGEPMLYPEIDELIAEFNRRNFTTFVVSNGQCVDKLKNLENEPYQLYLSLDAPTKKIYNDVCQPQISEGWDNLNQSLDTLASFNSRTCIRTTCVKGRNMTNPEKYAELIKKASPDFVEIKAYMCVGSSRHRLTPDNMPTFDEVKSFAQKIGENCGKKIVNESEVSRVVLLQ",
        "proteome": null,
        "gene": "taw1",
        "go_terms": [
            {
                "identifier": "GO:0003824",
                "name": "catalytic activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051536",
                "name": "iron-sulfur cluster binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051539",
                "name": "4 iron, 4 sulfur cluster binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008033",
                "name": "tRNA processing",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016829",
                "name": "lyase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "8f410f85842070b5c6f55e064c90b55a8cd35bca",
        "counters": {
            "domain_architectures": 1158,
            "entries": 18,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "profile": 1,
                "pfam": 2,
                "ssf": 1,
                "cdd": 1,
                "sfld": 3,
                "panther": 1,
                "hamap": 1,
                "ncbifam": 1,
                "interpro": 6
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 1158
        }
    }
}