HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "R4MGI1",
"id": "R4MGI1_MYCTX",
"source_organism": {
"taxId": "1310114",
"scientificName": "Mycobacterium tuberculosis CAS/NITR204",
"fullName": "Mycobacterium tuberculosis CAS/NITR204"
},
"name": "Transcription elongation factor GreA",
"description": [
"Necessary for efficient RNA polymerase transcription elongation past template-encoded arresting sites. The arresting sites in DNA have the property of trapping a certain fraction of elongating RNA polymerases that pass through, resulting in locked ternary complexes. Cleavage of the nascent transcript by cleavage factors such as GreA or GreB allows the resumption of elongation from the new 3'terminus. GreA releases sequences of 2 to 3 nucleotides"
],
"length": 164,
"sequence": "MTDTQVTWLTQESHDRLKAELDQLIANRPVIAAEINDRREEGDLRENGGYHAAREEQGQQEARIRQLQDLLSNAKVGEAPKQSGVALPGSVVKVYYNGDKSDSETFLIATRQEGVSDGKLEVYSPNSPLGGALIDAKVGETRSYTVPNGSTVSVTLVSAEPYHS",
"proteome": null,
"gene": "greA",
"go_terms": [
{
"identifier": "GO:0003677",
"name": "DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0032784",
"name": "regulation of DNA-templated transcription elongation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0070063",
"name": "RNA polymerase binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "82e5f38619df763e69d270190ffe1b4d3d25d5e1",
"counters": {
"domain_architectures": 32359,
"entries": 21,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 2,
"pfam": 2,
"ncbifam": 2,
"panther": 1,
"pirsf": 1,
"hamap": 1,
"prosite": 2,
"interpro": 8
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 32359
}
}
}