GET /api/protein/UniProt/R0LVG7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "R0LVG7",
"id": "R0LVG7_ANAPL",
"source_organism": {
"taxId": "8839",
"scientificName": "Anas platyrhynchos",
"fullName": "Anas platyrhynchos (Mallard)"
},
"name": "Protein NDNF",
"description": [
"Secretory protein that plays a role in various cellular processes. Acts as a chemorepellent acting on gonadotropin-releasing hormone (GnRH) expressing neurons regulating their migration to the hypothalamus. Also promotes neuron migration, growth and survival as well as neurite outgrowth and is involved in the development of the olfactory system. May also act through the regulation of growth factors activity and downstream signaling. Also regulates extracellular matrix assembly and cell adhesiveness. Promotes endothelial cell survival, vessel formation and plays an important role in the process of revascularization through NOS3-dependent mechanisms"
],
"length": 568,
"sequence": "MLLLHCPLLLLLLPLSSRTQKLPTRDEELFQMQIRDKAFFHDSSVVPDGAEISSYLFRDTPKRYFFVVEEDNTPLAVTVTPCDAPLEWKLSVQELPEEASGEGSGEPEPLEQQKQQIINEEGTELFSYKGNDVEYFVSSSSPSGLYQLDLLSTEKDTHFKVYATTTPESDQPYPELPYDPRIDVTSLGRTTVTLAWKPSPTASLLKQPIQYCIVINKEHNFKSLCAVEAKLSSDDAFMMAPKPGLDFSPFDFAHFGFPTDNNAGKERGFLKSSSKFGRQTSSKPRVDLHKVCIGNKNIFTVSDLKPDTQYYFDMFAVNTNTNMSTAYVGTFARTKEEAKQKTVELKDGKVTDVFIKRKGAKFLRFAPVSSHQKVTFSVHSCLDAVQIQVRRDGKLLLSQNVEGVRQFQLRGKAKAKYLIRLKGSKKGASVLKVLATTRPNKQSFPSLPEDTRIKAFDKLRTCSSVTVAWLGTQERNKFCIYKKEVDDNYNEEQKKREQNQCLGPDTRKKSEKVLCKYFHSQNIQKAVTTETIRGLQPGKSYLLDVYVIGHGGHSVKYQSKLVKTRKFC",
"proteome": "UP000296049",
"gene": "Anapl_05972",
"go_terms": [
{
"identifier": "GO:0005515",
"name": "protein binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "90ccbb833079d929fbbf1164858b6b54329b1cea",
"counters": {
"domain_architectures": 1374,
"entries": 14,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 3,
"ssf": 1,
"smart": 1,
"cathgene3d": 1,
"panther": 1,
"interpro": 7
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 1374
}
}
}