GET /api/protein/UniProt/Q9ZNJ8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q9ZNJ8",
"id": "DCDB_HATHI",
"source_organism": {
"taxId": "1498",
"scientificName": "Hathewaya histolytica",
"fullName": "Hathewaya histolytica"
},
"name": "dCTP deaminase, dUMP-forming",
"description": [
"Bifunctional enzyme that catalyzes both the deamination of dCTP to dUTP and the hydrolysis of dUTP to dUMP without releasing the toxic dUTP intermediate"
],
"length": 172,
"sequence": "MILSGKEIKNRLNKDIFIEPFSDNQLNPNSYNLRLHNELLVYENNVLDMKKENKAKKITIPEEGLLLEPGKLYLGRTIEHTRTEKLVPMLEGRSSVGRLGLFIHITAGFGDIGFSGFWTLEIFCVQPIRIYPNIEICQIYYHNIEGEYEKYTSGKYQNNTGVQPSLLFKDFE",
"proteome": null,
"gene": "dcd",
"go_terms": [
{
"identifier": "GO:0008829",
"name": "dCTP deaminase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006229",
"name": "dUTP biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "f774514846d93fa2755fff8e65204fb50c24e420",
"counters": {
"domain_architectures": 17395,
"entries": 10,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"pfam": 1,
"cdd": 1,
"hamap": 1,
"panther": 1,
"ncbifam": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 17395
}
}
}