GET /api/protein/UniProt/Q9ZJE3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q9ZJE3",
        "id": "UBIX_HELPJ",
        "source_organism": {
            "taxId": "85963",
            "scientificName": "Helicobacter pylori (strain J99 / ATCC 700824)",
            "fullName": "Helicobacter pylori (strain J99 / ATCC 700824)"
        },
        "name": "Flavin prenyltransferase UbiX",
        "description": [
            "Flavin prenyltransferase that catalyzes the synthesis of the prenylated FMN cofactor (prenyl-FMN) for 4-hydroxy-3-polyprenylbenzoic acid decarboxylase UbiD. The prenyltransferase is metal-independent and links a dimethylallyl moiety from dimethylallyl monophosphate (DMAP) to the flavin N5 and C6 atoms of FMN"
        ],
        "length": 187,
        "sequence": "MKLVLGISGASGIPLALRFLEKLPKEIEIFVVASKNAHVVALEESNINLKNAMKDLRPSATFFNEQDIHASIASGSYGIHKMAIIPASMDMVAKIAHGFGGDLISRSASVMLKEKRPLLIAPREMPLSAIMLENLLKLAHSNAIIAPPMMTYYTQSKTLEAMQDFLVGKWFDSLGIENDLYPRWGMN",
        "proteome": null,
        "gene": "ubiX",
        "go_terms": [
            {
                "identifier": "GO:0003824",
                "name": "catalytic activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "a8d4bade61d095bea50675bf04b899cb1d7578d3",
        "counters": {
            "domain_architectures": 29049,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "ssf": 1,
                "cathgene3d": 1,
                "hamap": 1,
                "ncbifam": 2,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 29049
        }
    }
}