GET /api/protein/UniProt/Q9Z8P0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q9Z8P0",
"id": "FABH_CHLPN",
"source_organism": {
"taxId": "83558",
"scientificName": "Chlamydia pneumoniae",
"fullName": "Chlamydia pneumoniae"
},
"name": "Beta-ketoacyl-[acyl-carrier-protein] synthase III",
"description": [
"Catalyzes the condensation reaction of fatty acid synthesis by the addition to an acyl acceptor of two carbons from malonyl-ACP. Catalyzes the first condensation reaction which initiates fatty acid synthesis and may therefore play a role in governing the total rate of fatty acid production. Possesses both acetoacetyl-ACP synthase and acetyl transacylase activities. Its substrate specificity determines the biosynthesis of branched-chain and/or straight-chain of fatty acids"
],
"length": 335,
"sequence": "MWFSVNKNKKAAIWATGSYLPEKVLSNADLEKMVDTSDEWIVTRTGIKERRIAGPQEYTSLMGAIAAEKAIANAGLSKDQIDCIIFSTAAPDYIFPSSGALAQAHLGIEDVPTFDCQAACTGYLYGLSVAKAYVESGTYNHVLLIAADKLSSFVDYTDRNTCVLFGDGGAACVIGESRPGSLEINRLSLGADGKLGELLSLPAGGSRCPASKETLQSGKHFIAMEGKEVFKHAVRRMETAAKHSIALAGIQEEDIDWFVPHQANERIIDALAKRFEIDESRVFKSVHKYGNTAASSVGIALDELVHTESIKLDDYLLLVAFGGGLSWGAVVLKQV",
"proteome": "UP000000424",
"gene": "fabH",
"go_terms": [
{
"identifier": "GO:0016746",
"name": "acyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004315",
"name": "3-oxoacyl-[acyl-carrier-protein] synthase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006633",
"name": "fatty acid biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "f650d7454ccec3fefdcbdcad813648104ddb697c",
"counters": {
"domain_architectures": 45931,
"entries": 13,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"pfam": 2,
"ncbifam": 2,
"panther": 1,
"hamap": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 45931
}
}
}