GET /api/protein/UniProt/Q9Z2F2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q9Z2F2",
        "id": "OASL2_MOUSE",
        "source_organism": {
            "taxId": "10090",
            "scientificName": "Mus musculus",
            "fullName": "Mus musculus (Mouse)"
        },
        "name": "2'-5'-oligoadenylate synthase-like protein 2",
        "description": [
            "Interferon-induced, dsRNA-activated antiviral enzyme which plays a critical role in cellular innate antiviral response. Synthesizes oligomers of 2'-5'-oligoadenylates (2-5A) from ATP which then bind to the inactive monomeric form of ribonuclease L (RNase L) leading to its dimerization and subsequent activation. Activation of RNase L leads to degradation of cellular as well as viral RNA, resulting in the inhibition of protein synthesis, thus terminating viral replication. Can mediate the antiviral effect via the classical RNase L-dependent pathway or an alternative antiviral pathway independent of RNase L"
        ],
        "length": 508,
        "sequence": "MDPFPDLYATPGDSLDHFLEHSLQPQRDWKEEGQDAWERIERFFREQCFRDELLLDQEVRVIKVVKGGSSGKGTTLNHRSDQDMILFLSCFSSFEEQARNREVVISFIKKRLIHCSRSLAYNIIVLTHREGKRAPRSLTLKVQSRKTDDIIWMDILPAYDALGPISRDSKPAPAIYETLIRSKGYPGDFSPSFTELQRHFVKTRPVKLKNLLRLVKFWYLQCLRRKYGRGAVLPSKYALELLTIYAWEMGTESSDSFNLDEGFVAVMELLVNYRDICIYWTKYYNFQNEVVRNFLKKQLKGDRPIILDPADPTNNLGRRKGWEQVAAEAAFCLLQVCCTTVGPSERWNVQRARDVQVRVKQTGTVDWTLWTNPYSPIRKMKAEIRREKNFGGELRISFQEPGGERQLLSSRKTLADYGIFSKVNIQVLETFPPEILVFVKYPGGQSKPFTIDPDDTILDLKEKIEDAGGPCAEDQVLLLDDEELEDDESLKELEIKDCDTIILIRVID",
        "proteome": "UP000000589",
        "gene": "Oasl2",
        "go_terms": [
            {
                "identifier": "GO:0016779",
                "name": "nucleotidyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "bb127f5035960ba2d88bad30163bddc812d41110",
        "counters": {
            "domain_architectures": 309,
            "entries": 23,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 3,
                "ssf": 3,
                "profile": 2,
                "cdd": 2,
                "pfam": 2,
                "smart": 1,
                "panther": 1,
                "prosite": 2,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 309
        }
    }
}