GET /api/protein/UniProt/Q9Z1N6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q9Z1N6",
        "id": "SFRP4_MOUSE",
        "source_organism": {
            "taxId": "10090",
            "scientificName": "Mus musculus",
            "fullName": "Mus musculus (Mouse)"
        },
        "name": "Secreted frizzled-related sequence protein 4",
        "description": [
            "Soluble frizzled-related proteins (sFRPS) function as modulators of Wnt signaling through direct interaction with Wnts. They have a role in regulating cell growth and differentiation in specific cell types (PubMed:27355534). SFRP4 plays a role in bone morphogenesis (PubMed:27355534). May also act as a regulator of adult uterine morphology and function. May also increase apoptosis during ovulation possibly through modulation of FZ1/FZ4/WNT4 signaling (By similarity). Has phosphaturic effects by specifically inhibiting sodium-dependent phosphate uptake (By similarity)"
        ],
        "length": 351,
        "sequence": "MLRSILVALCLWLRLALGVRGAPCEAVRIPMCRHMPWNITRMPNHLHHSTQENAILAIEQYEELVDVNCSSVLRFFLCAMYAPICTLEFLHDPIKPCKSVCQRARDDCEPLMKMYNHSWPESLACDELPVYDRGVCISPEAIVTDLPEDVKWIDITPDMMVQERSFDADCKRLSPDRCKCKKVKPTLATYLSKNYSYVIHAKIKAVQRSGCNEVTTVVDVKEIFKSLSPIPRTQVPLITNSSCQCPHILPHQDVLIMCYEWRSRMMLLENCLVEKWRDQLSRRSIQWEERLQEQQRTIQDKKQIASRTSRTSRSNPPKSKGRPPAPKPASPKKNIKARSAPKKSNLKKSAS",
        "proteome": "UP000000589",
        "gene": "Sfrp4",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "f8a655922328c0c2a242c85dc64e70c2a18e5657",
        "counters": {
            "domain_architectures": 3784,
            "entries": 17,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 2,
                "cathgene3d": 2,
                "ssf": 2,
                "smart": 2,
                "pfam": 2,
                "panther": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3784
        }
    }
}