General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q9Y7J1",
        "id": "SPO6_SCHPO",
        "source_organism": {
            "taxId": "284812",
            "scientificName": "Schizosaccharomyces pombe (strain 972 / ATCC 24843)",
            "fullName": "Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)"
        },
        "name": "Sporulation-specific protein 6",
        "description": [
            "May act as a kinase regulator. Essential for progression of meiosis II and sporulation"
        ],
        "length": 474,
        "sequence": "MDFYSVKSQPFVRSPLVDQNPSIQNINEEVKRDIQNPLSYKTETSDKELCQTAACATSCSDWYPQQQTHMPHQNAFDSAKATAKMALPPTAFSNYCVKPSLTRNKDIPRTSIRVSKLRYWQRDYRLAFPNFIFYFDNVDEEIKRRVTQKINNLGAKVATLFTFEVTHFITTRTTDPEMCQPNDVLYLSKTANMKIWLLDKLLNRILFTLLNSDSLVNTSASCLQSLLDGEKVYGTSDKDFYVPSKNVEYFREYFLCIRDLSQYYKPIAVREWEKTLDSGEILWPSLAITAQGRCPFNTGRRRELKITKHNHPAHEIRKQLLSCTNQTNQNNVVKNSASVLVRQIMGDYNITESAVDGAKQMPTEFPKPENLLPVEKRAAMSPLNLLEPRLINKQNTLANQSPRQPPNAFDADPLAHKKVKIETKSGYCENCCERYKDLERHLGGKHHRRFAEKDENFQGLDDLFLLIRRPIRTN",
        "proteome": "UP000002485",
        "gene": "spo6",
        "go_terms": [
            {
                "identifier": "GO:0003676",
                "name": "nucleic acid binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008270",
                "name": "zinc ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "b5a1083d881c4adec5056c44e26e3627ba0b541f",
        "counters": {
            "domain_architectures": 1283,
            "entries": 16,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 2,
                "cdd": 1,
                "pfam": 3,
                "smart": 1,
                "profile": 1,
                "panther": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1283
        }
    }
}