General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q9Y1B2",
        "id": "ORC6_DROME",
        "source_organism": {
            "taxId": "7227",
            "scientificName": "Drosophila melanogaster",
            "fullName": "Drosophila melanogaster (Fruit fly)"
        },
        "name": "Origin recognition complex subunit 6",
        "description": [
            "Component of the origin recognition complex (ORC) that binds origins of replication. DNA-binding is ATP-dependent, however specific DNA sequences that define origins of replication have not been identified so far. ORC is required to assemble the pre-replication complex necessary to initiate DNA replication (By similarity)"
        ],
        "length": 257,
        "sequence": "MTTLIEQLITKMGLREEPNVLEKTTELVRLLELRSTNVPLQINEYGKIVLCADLASCMIGIAFDKEQALKLSGLRKSQYLNNKRMFEKLLDLNKLASVNDICVQLGLNEVARKAEELMTLFKGVAATEDMGTDTSHPQYATMAVFQACRLLKKKVSKSKLMPFSNLRPSQFQLLEQQWERMIAKHHKESKVPSSTDMEGKLKENQNENIKGHEAKKAHKPPPEDYEIWKARMLAKAQAKLKELEASQSHMDSQLLEA",
        "proteome": "UP000000803",
        "gene": "Orc6",
        "go_terms": [
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006260",
                "name": "DNA replication",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005664",
                "name": "nuclear origin of replication recognition complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "a614704ef6632d5e1aec73f13bcce9c15d661d07",
        "counters": {
            "domain_architectures": 1705,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 8,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 2,
                "cdd": 2,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1705
        }
    }
}