General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q9W6B4",
        "id": "TIMP3_SCYTO",
        "source_organism": {
            "taxId": "75743",
            "scientificName": "Scyliorhinus torazame",
            "fullName": "Scyliorhinus torazame (Cloudy catshark)"
        },
        "name": "Metalloproteinase inhibitor 3",
        "description": [
            "Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. May form part of a tissue-specific acute response to remodeling stimuli (By similarity)"
        ],
        "length": 214,
        "sequence": "MVFSTTAALSLLLALSSMQLSEVSEACTCMPNHPQEAFCNSDIVIRAKVVGKKLLKDGPFGTMRYTIKQMKMYRGFSKMQQVQYIYTEAAESLCGVRLQVNKFQYLITGRVFDGEVYTGVCNFIVPWDRLTLSQRKGLNHRYQYGCNCKIKPCYYLPCFVTAKNECFWTDMLSDQGYMGHQAKHYVCIRQKEGYCSWYRGAAPPDKTRINATDP",
        "proteome": null,
        "gene": "TIMP3",
        "go_terms": [
            {
                "identifier": "GO:0008191",
                "name": "metalloendopeptidase inhibitor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "0069a2795ffedf1b536a9737eb97886b41506e9e",
        "counters": {
            "domain_architectures": 5091,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "profile": 1,
                "smart": 1,
                "cathgene3d": 2,
                "ssf": 1,
                "cdd": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 5091
        }
    }
}