GET /api/protein/UniProt/Q9VTE5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q9VTE5",
"id": "PFD2_DROME",
"source_organism": {
"taxId": "7227",
"scientificName": "Drosophila melanogaster",
"fullName": "Drosophila melanogaster (Fruit fly)"
},
"name": "Probable prefoldin subunit 2",
"description": [
"Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins (By similarity)"
],
"length": 143,
"sequence": "MSTESAKPALSQEAIVAQFQQLRNEQRNLVNSLNTLEMDLREHKTVIETLEAADPERKCFRQIGGVLCERTVKEVLPQLVENKDFIAKTIQMVTNDLSKKGSELNKFKEEHNIKIRGEHLVAEGAKGDDAEDKAENRNVLVFN",
"proteome": "UP000000803",
"gene": "Pfdn2",
"go_terms": [
{
"identifier": "GO:0006457",
"name": "protein folding",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016272",
"name": "prefoldin complex",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0051082",
"name": "unfolded protein binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 1,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "36da8b118b3212d7c40ed89855e8fd9deedb7b2d",
"counters": {
"domain_architectures": 17674,
"entries": 8,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"panther": 1,
"pfam": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 17674
}
}
}