General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q9VQ57",
        "id": "DERL1_DROME",
        "source_organism": {
            "taxId": "7227",
            "scientificName": "Drosophila melanogaster",
            "fullName": "Drosophila melanogaster (Fruit fly)"
        },
        "name": "Derlin-1",
        "description": [
            "May be involved in the degradation process of specific misfolded endoplasmic reticulum (ER) luminal proteins. May also involved in endoplasmic reticulum stress-induced pre-emptive quality control, a mechanism that selectively attenuates the translocation of newly synthesized proteins into the endoplasmic reticulum and reroutes them to the cytosol for proteasomal degradation"
        ],
        "length": 245,
        "sequence": "MDAGVWYRSLPRFTRYWLTATVVLSMLCRFDVIPLHWLHLDRSAVFSKLQLWRCMTSLFVFPISSNTAFHFLINCFFIVQYSSKLEKDQYSRSPADYLYLLIVSAVLANIGGMIFNVYFLMDTLVLAITYIWCQLNKDVTVSFWFGTRFKAMYLPWVLAAFEFIFHFSLASLVGIFVGHVYYFFKFQYSQDLGGTPLLETPQFLKRLVPDVSGGFGGFGLPPESRAPPRQATESPWGRGMTLGRN",
        "proteome": "UP000000803",
        "gene": "Der-1",
        "go_terms": null,
        "protein_evidence": 2,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "5e289f64f63688d2c84bfacb1b0e28f6212c66ce",
        "counters": {
            "domain_architectures": 11300,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 11300
        }
    }
}