GET /api/protein/UniProt/Q9VQ57/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q9VQ57",
"id": "DERL1_DROME",
"source_organism": {
"taxId": "7227",
"scientificName": "Drosophila melanogaster",
"fullName": "Drosophila melanogaster (Fruit fly)"
},
"name": "Derlin-1",
"description": [
"May be involved in the degradation process of specific misfolded endoplasmic reticulum (ER) luminal proteins. May also involved in endoplasmic reticulum stress-induced pre-emptive quality control, a mechanism that selectively attenuates the translocation of newly synthesized proteins into the endoplasmic reticulum and reroutes them to the cytosol for proteasomal degradation"
],
"length": 245,
"sequence": "MDAGVWYRSLPRFTRYWLTATVVLSMLCRFDVIPLHWLHLDRSAVFSKLQLWRCMTSLFVFPISSNTAFHFLINCFFIVQYSSKLEKDQYSRSPADYLYLLIVSAVLANIGGMIFNVYFLMDTLVLAITYIWCQLNKDVTVSFWFGTRFKAMYLPWVLAAFEFIFHFSLASLVGIFVGHVYYFFKFQYSQDLGGTPLLETPQFLKRLVPDVSGGFGGFGLPPESRAPPRQATESPWGRGMTLGRN",
"proteome": "UP000000803",
"gene": "Der-1",
"go_terms": null,
"protein_evidence": 2,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "5e289f64f63688d2c84bfacb1b0e28f6212c66ce",
"counters": {
"domain_architectures": 11300,
"entries": 5,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"panther": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 11300
}
}
}