HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q9UIJ7",
"id": "KAD3_HUMAN",
"source_organism": {
"taxId": "9606",
"scientificName": "Homo sapiens",
"fullName": "Homo sapiens (Human)"
},
"name": "GTP:AMP phosphotransferase AK3, mitochondrial",
"description": [
"Mitochondrial adenylate kinase with a specific GTP:AMP phosphotransferase activity (PubMed:11485571, PubMed:32822537). Could also use ITP as phosphate donor (PubMed:11485571). Its physiological function is to recycle GTP into GDP which is necessary for the TCA cycle in the mitochondrial matrix (Probable)"
],
"length": 227,
"sequence": "MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDVMTRLALHELKNLTQYSWLLDGFPRTLPQAEALDRAYQIDTVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEDQTKPVLEYYQKKGVLETFSGTETNKIWPYVYAFLQTKVPQRSQKASVTP",
"proteome": "UP000005640",
"gene": "AK3",
"go_terms": [
{
"identifier": "GO:0005524",
"name": "ATP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0019205",
"name": "nucleobase-containing compound kinase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006139",
"name": "nucleobase-containing compound metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0004017",
"name": "AMP kinase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005739",
"name": "mitochondrion",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0016776",
"name": "phosphotransferase activity, phosphate group as acceptor",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 1,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "cd3ce6da6122bbe1e4b04d5ae2a462ecdf76a3f9",
"counters": {
"domain_architectures": 27793,
"entries": 19,
"isoforms": 3,
"proteomes": 1,
"sets": 3,
"structures": 4,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"cdd": 1,
"ssf": 2,
"pfam": 2,
"hamap": 2,
"panther": 1,
"ncbifam": 1,
"prosite": 1,
"prints": 1,
"interpro": 7
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 27793
}
}
}