GET /api/protein/UniProt/Q9RY51/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q9RY51",
"id": "SSB_DEIRA",
"source_organism": {
"taxId": "243230",
"scientificName": "Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)",
"fullName": "Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)"
},
"name": "Single-stranded DNA-binding protein",
"description": [
"Plays an important role in DNA replication, recombination and repair. Binds to ssDNA and to an array of partner proteins to recruit them to their sites of action during DNA metabolism (By similarity). Essential for ionizing radiation resistance. Stimulates the 5'-3' DNA helicase activity of RecD-like helicase. Stimulates RecA protein-promoted DNA three-strand exchange reactions in vitro with both D.radiodurans and E.coli-derived RecA. Complements an ssb deletion in E.coli, but does not complement a ddrb disruption in D.radiodurans"
],
"length": 301,
"sequence": "MARGMNHVYLIGALARDPELRYTGNGMAVFEATVAGEDRVIGNDGRERNLPWYHRVSILGKPAEWQAERNLKGGDAVVVEGTLEYRQWEAPEGGKRSAVNVKALRMEQLGTQPELIQDAGGGVRMSGAMNEVLVLGNVTRDPEIRYTPAGDAVLSLSIAVNENYQDRQGQRQEKVHYIDATLWRDLAENMKELRKGDPVMIMGRLVNEGWTDKDGNKRNSTRVEATRVEALARGAGNANSGYAAATPAAPRTQTASSAARPTSGGYQSQPSRAANTGSRSGGLDIDQGLDDFPPEEDDLPF",
"proteome": "UP000002524",
"gene": "ssb",
"go_terms": [
{
"identifier": "GO:0003697",
"name": "single-stranded DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006260",
"name": "DNA replication",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 1,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "574a669c6cc0a23b30b32589f6c262598890c761",
"counters": {
"domain_architectures": 290,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 3,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"profile": 1,
"cdd": 1,
"panther": 1,
"ncbifam": 1,
"hamap": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 290
}
}
}