General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q9PZK3",
        "id": "Q9PZK3_IH5N1",
        "source_organism": {
            "taxId": "100851",
            "scientificName": "Influenza A virus (A/Duck/Hong Kong/y283/97 (H5N1))",
            "fullName": "Influenza A virus (A/Duck/Hong Kong/y283/97 (H5N1))"
        },
        "name": "Matrix protein 2",
        "description": [
            "Forms a proton-selective ion channel that is necessary for the efficient release of the viral genome during virus entry"
        ],
        "length": 95,
        "sequence": "SLLTEVETLTRNGWGCRCSDSSDPLVVAASIIGILHLILWILDRLFFKCIYRRFKYGLKRGPPTEGVLESMREEYRQEQQNAVDVDDGHFVNIEL",
        "proteome": null,
        "gene": "M",
        "go_terms": [
            {
                "identifier": "GO:0015078",
                "name": "proton transmembrane transporter activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:1902600",
                "name": "proton transmembrane transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0033644",
                "name": "host cell membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0055036",
                "name": "virion membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "e6d923ab963dc33a4b3f474023342d9fc49fd6e6",
        "counters": {
            "domain_architectures": 64325,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 64325
        }
    }
}