General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q9PKF1",
        "id": "LPXD_CHLMU",
        "source_organism": {
            "taxId": "243161",
            "scientificName": "Chlamydia muridarum (strain MoPn / Nigg)",
            "fullName": "Chlamydia muridarum (strain MoPn / Nigg)"
        },
        "name": "UDP-3-O-acylglucosamine N-acyltransferase",
        "description": [
            "Catalyzes the N-acylation of UDP-3-O-acylglucosamine using 3-hydroxyacyl-ACP as the acyl donor. Is involved in the biosynthesis of lipid A, a phosphorylated glycolipid that anchors the lipopolysaccharide to the outer membrane of the cell"
        ],
        "length": 354,
        "sequence": "MSQPVYSLKQLADFLNVEFQGNGATLLSGVEEIGEAKAAHVTFLDNEKYAKHLKSSEAGAIILSRTQFQKYRELNKNFLIVSESPSLVFQKCLELFIAPVDSGFPGIHPTAVIHPTAIIEEHVCIEPYVVICQHARIGAACHIGTGSVIGAHSSIGEHSYIYPRVVVRERVSIGKRVIIQPGAIIGSCGFGYVTSAFGQHKHLKHLGTVIIEDDVEIGANTTIDRGRFKHSIVREGSKIDNLVQIAHQVEVGQHSMVVAQAGIAGSTKIGNHVIIGGQAGVTGHICIADHVIMMAQTGVTKSITSPGIYGGAPARPYQEVHRQVAKIRNLPRLEERIASLEKLVQKLEALSEQH",
        "proteome": "UP000000800",
        "gene": "lpxD",
        "go_terms": [
            {
                "identifier": "GO:0016747",
                "name": "acyltransferase activity, transferring groups other than amino-acyl groups",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009245",
                "name": "lipid A biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016410",
                "name": "N-acyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ea218c6a4c5644d0db979f2645b28c18c27f70d7",
        "counters": {
            "domain_architectures": 5046,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 3,
                "pfam": 2,
                "ssf": 1,
                "cdd": 1,
                "ncbifam": 2,
                "panther": 1,
                "hamap": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 5046
        }
    }
}