GET /api/protein/UniProt/Q9PGB5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q9PGB5",
        "id": "DUSA_XYLFA",
        "source_organism": {
            "taxId": "160492",
            "scientificName": "Xylella fastidiosa (strain 9a5c)",
            "fullName": "Xylella fastidiosa (strain 9a5c)"
        },
        "name": "tRNA-dihydrouridine(20/20a) synthase",
        "description": [
            "Catalyzes the synthesis of 5,6-dihydrouridine (D), a modified base found in the D-loop of most tRNAs, via the reduction of the C5-C6 double bond in target uridines. Specifically modifies U20 and U20a in tRNAs"
        ],
        "length": 340,
        "sequence": "MIPVINQEKQGISGDFRLSVAPMMNWTDRYCRVFHRVLAPSARLYTEMVHAKAVIYGDRERLLGFASVEQPVALQLGGSEPALLAKAARIAVDWGYSEINLNCGCPSDRVQAGSFGARLMREPALVADCVAAMAAVVSVPVTVKCRLGVNEDDDYGRFAKFVDWVSRASSSRMIVVHARNAWLQGLSPKENREIPPLRYDWVYRLKRERPELAVVLNGGITSVEAGLDHLLMVDGVMLGRAAYQDPYILHQFDCALSNAPLLPRALLLRALRPYVEVWLEQGLTLRHIVRHLFGLFHGQPGGRVFRQVLTQGGQRSDADWSLVEQALSIIEDQETYAAVV",
        "proteome": null,
        "gene": "dusA",
        "go_terms": [
            {
                "identifier": "GO:0017150",
                "name": "tRNA dihydrouridine synthase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0002943",
                "name": "tRNA dihydrouridine synthesis",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0050660",
                "name": "flavin adenine dinucleotide binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008033",
                "name": "tRNA processing",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "472d8faf270aff0fc25e3ad6bc9e20ee1e59630e",
        "counters": {
            "domain_architectures": 57766,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "cdd": 1,
                "ssf": 1,
                "pfam": 1,
                "ncbifam": 1,
                "pirsf": 1,
                "hamap": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 57766
        }
    }
}