GET /api/protein/UniProt/Q9N4X8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q9N4X8",
        "id": "GSTPA_CAEEL",
        "source_organism": {
            "taxId": "6239",
            "scientificName": "Caenorhabditis elegans",
            "fullName": "Caenorhabditis elegans"
        },
        "name": "Glutathione S-transferase P 10",
        "description": [
            "Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Responsible for approximately one-third of 4-hydroxy-2-nonenal conjugation (PubMed:16164425, PubMed:16300482, Ref.1). May play a role in the detoxification of reactive oxygen species produced during pathogenic bacterial infection (PubMed:22216003)"
        ],
        "length": 210,
        "sequence": "MAVPQLYYFTIRGFGEYIRLLFLDNGIKFEDIRFDYEGNEWQEFKKGMLLGQLPCLKVDGQEIVQTGAIMRHLGRVHGLNGSNEQEATFLDMFFEGVRDVRMKYVRYIYYDEGTREDCVNKTIPEALVKLEELFKAHSGDFIIGNKISYADYILFEELDVYHVLDANILDKFPTLKSFWERMWKRPNLNAYLEKRKADKVWINAIEKGMN",
        "proteome": "UP000001940",
        "gene": "gst-10",
        "go_terms": null,
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "3c8295a330c09bde936e9b1d621b2d95072ea793",
        "counters": {
            "domain_architectures": 15127,
            "entries": 20,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 2,
                "cdd": 1,
                "ssf": 2,
                "pfam": 2,
                "cathgene3d": 2,
                "panther": 1,
                "sfld": 3,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 15127
        }
    }
}