HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q9MU33",
"id": "Q9MU33_MORNI",
"source_organism": {
"taxId": "85232",
"scientificName": "Morus nigra",
"fullName": "Morus nigra (Black mulberry)"
},
"name": "ATP synthase subunit beta",
"description": [
"Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Subunits alpha and beta form the catalytic core in F(1). Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits",
"Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits"
],
"length": 486,
"sequence": "RINPTXXCSGVPALEKKNLGRIAQIIGPVLDVAFPPGKMPNIYNALVVXGRDTVGQQINVTCEVQQLLGNNRVRAVAMSATDGLMRGMEVIDTGAPISVPVGGATLGRIFNVLGEPIDNLGPVDTRTTSPIHRSAPAFIQLDTXLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDGLPEQAFYLVGNIDEATAKA",
"proteome": null,
"gene": "atpB",
"go_terms": [
{
"identifier": "GO:0046034",
"name": "ATP metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:1902600",
"name": "proton transmembrane transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005524",
"name": "ATP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0046933",
"name": "proton-transporting ATP synthase activity, rotational mechanism",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0015986",
"name": "proton motive force-driven ATP synthesis",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0045259",
"name": "proton-transporting ATP synthase complex",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": false,
"in_bfvd": false,
"ida_accession": "d079caac124722904c86efe2303dd63e1f2836bb",
"counters": {
"domain_architectures": 58128,
"entries": 27,
"isoforms": 0,
"proteomes": 0,
"sets": 5,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 3,
"ssf": 3,
"cdd": 3,
"pfam": 3,
"smart": 1,
"panther": 1,
"hamap": 1,
"ncbifam": 1,
"prosite": 1,
"interpro": 10
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 58128
}
}
}