General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q9MAB9",
        "id": "MUB1_ARATH",
        "source_organism": {
            "taxId": "3702",
            "scientificName": "Arabidopsis thaliana",
            "fullName": "Arabidopsis thaliana (Mouse-ear cress)"
        },
        "name": "Membrane-anchored ubiquitin-fold protein 1",
        "description": [
            "May serve as docking site to facilitate the association of other proteins to the plasma membrane"
        ],
        "length": 117,
        "sequence": "MAEVHNQLEIKFRLTDGSDIGPKAFPDATTVSALKETVISEWPREKENGPKTVKEVKLISAGKVLENSKTVKDYRSPVSNLAGAVTTMHVIIQAPVTEKEKKPKGDPKMNKCVCSVM",
        "proteome": "UP000006548",
        "gene": "MUB1",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "3a8f88f49338f68a2d21484f711bb7d5dc632cc8",
        "counters": {
            "domain_architectures": 6436,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 1,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "pfam": 1,
                "profile": 1,
                "panther": 1,
                "pirsf": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 6436
        }
    }
}