GET /api/protein/UniProt/Q9M2E2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q9M2E2",
"id": "SDR1_ARATH",
"source_organism": {
"taxId": "3702",
"scientificName": "Arabidopsis thaliana",
"fullName": "Arabidopsis thaliana (Mouse-ear cress)"
},
"name": "(+)-neomenthol dehydrogenase",
"description": [
"Aldehyde reductase that catalyzes the reduction of the aldehyde carbonyl groups on saturated and alpha,beta-unsaturated aldehydes with more than 5 carbons (PubMed:21169366). Involved in basal resistance against pathogens"
],
"length": 296,
"sequence": "MAEETPRYAVVTGANRGIGFEICRQLASEGIRVVLTSRDENRGLEAVETLKKELEISDQSLLFHQLDVADPASITSLAEFVKTQFGKLDILVNNAGIGGIITDAEALRAGAGKEGFKWDEIITETYELTEECIKINYYGPKRMCEAFIPLLKLSDSPRIVNVSSSMGQLKNVLNEWAKGILSDAENLTEERIDQVINQLLNDFKEGTVKEKNWAKFMSAYVVSKASLNGYTRVLAKKHPEFRVNAVCPGFVKTDMNFKTGVLSVEEGASSPVRLALLPHQETPSGCFFSRKQVSEF",
"proteome": "UP000006548",
"gene": "SDR1",
"go_terms": [
{
"identifier": "GO:0016616",
"name": "oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 1,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "c3a3bff32c8c83caeb8966afe63d186d44ef6319",
"counters": {
"domain_architectures": 13297,
"entries": 11,
"isoforms": 1,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"pfam": 2,
"panther": 1,
"prints": 2,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 13297
}
}
}