HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q9LDQ7",
"id": "METK_CAMSI",
"source_organism": {
"taxId": "4442",
"scientificName": "Camellia sinensis",
"fullName": "Camellia sinensis (Tea plant)"
},
"name": "S-adenosylmethionine synthase",
"description": [
"Catalyzes the formation of S-adenosylmethionine from methionine and ATP. The reaction comprises two steps that are both catalyzed by the same enzyme: formation of S-adenosylmethionine (AdoMet) and triphosphate, and subsequent hydrolysis of the triphosphate"
],
"length": 393,
"sequence": "METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDQDSKVACETCTKTNMVMVFGEITTKAAVDYEKIVRDTCRTIGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKRPEEIGAGDQGHMFGYATDETSELMPLSHVLATKLGARLTEVRKNGTCPWLRPDGKTQVTVEYYNEKGATVPIRVHTLLISTQHDETVTNDEIAADLKEHVIKPVIPDKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDTYGTGKIPDKEILKIVKESFDFRPGMIAINLDLKRGGNSRFLKTAAYGHFGRDDPDFTWESGEAPQVGQTSS",
"proteome": null,
"gene": "SAM",
"go_terms": [
{
"identifier": "GO:0004478",
"name": "methionine adenosyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006556",
"name": "S-adenosylmethionine biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005524",
"name": "ATP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 2,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "19eaff5c12f42b31629adc7742ec6ffb3fe068a7",
"counters": {
"domain_architectures": 35253,
"entries": 18,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"pfam": 3,
"cathgene3d": 1,
"cdd": 1,
"panther": 1,
"pirsf": 1,
"hamap": 1,
"ncbifam": 1,
"prosite": 2,
"interpro": 6
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 35253
}
}
}