General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q9KVZ7",
        "id": "T2X1_XANVA",
        "source_organism": {
            "taxId": "56459",
            "scientificName": "Xanthomonas vasicola",
            "fullName": "Xanthomonas vasicola"
        },
        "name": "Type II restriction enzyme XhoI",
        "description": [
            "A P subtype restriction enzyme that recognizes the double-stranded sequence 5'-CTCGAG-3' and cleaves after C-1"
        ],
        "length": 248,
        "sequence": "MALDLAEYDRLARLGVAQFWDGRSSALENDEERSQGGERSGVLGGRNMDGFLAMIEGIVRKNGLPDAEVCIKGRPNLTLPGYYRPTKLWDVLVFDGKKLVAAVELKSHVGPSFGNNFNNRAEEAIGTAHDLATAIREGILGDQLPPFTGWLILVEDCEKSKRAVRDSSPHFPVFPDFKGASYLTRYEVLCRKLILKGFTPRPQSLLRPALRVLGATIASFRKPRVCAHLRHGWPAMYPVGQSRIRVNF",
        "proteome": null,
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009036",
                "name": "type II site-specific deoxyribonuclease activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009307",
                "name": "DNA restriction-modification system",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "8f46b9e6b44e1cbd8cbc2b82d24f764aba16bf93",
        "counters": {
            "domain_architectures": 399,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pirsf": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 399
        }
    }
}