HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q9KPB2",
"id": "RNC_VIBCH",
"source_organism": {
"taxId": "243277",
"scientificName": "Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)",
"fullName": "Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)"
},
"name": "Ribonuclease 3",
"description": [
"Digests double-stranded RNA. Involved in the processing of primary rRNA transcript to yield the immediate precursors to the large and small rRNAs (23S and 16S). Processes some mRNAs, and tRNAs when they are encoded in the rRNA operon. Processes pre-crRNA and tracrRNA of type II CRISPR loci if present in the organism"
],
"length": 225,
"sequence": "MTPPMNKLTSKLGYTFKETELLNLALTHRSANGKHNERLEFLGDSILSFVIADELYRRFPKVNEGDMSRMRATLVRGNTLAELGREFDLGDYLKLGPGELKSGGFRRDSILADAVEAIIGAIYLDSDLETARSIVLEWYHGRLEEIKPGASQKDPKTRLQEFLQGRRKPLPVYTVTNIKGEAHNQEFTVACEVAGMDTPVIGKGTSRRKAEQAAAETALEQLTNG",
"proteome": "UP000000584",
"gene": "rnc",
"go_terms": [
{
"identifier": "GO:0004525",
"name": "ribonuclease III activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006396",
"name": "RNA processing",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0003723",
"name": "RNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006364",
"name": "rRNA processing",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "1d1b93569d189b9d241b69a8f442a66312c2282e",
"counters": {
"domain_architectures": 25316,
"entries": 20,
"isoforms": 0,
"proteomes": 1,
"sets": 4,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"profile": 2,
"ssf": 2,
"cdd": 2,
"smart": 2,
"pfam": 2,
"hamap": 1,
"ncbifam": 1,
"panther": 1,
"prosite": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 25316
}
}
}