GET /api/protein/UniProt/Q9JSY6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q9JSY6",
"id": "UPPP_NEIMA",
"source_organism": {
"taxId": "122587",
"scientificName": "Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)",
"fullName": "Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)"
},
"name": "Undecaprenyl-diphosphatase",
"description": [
"Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin"
],
"length": 273,
"sequence": "MDFLIVLKALMMGLVEGFTEFLPISSTGHLIVFGNLIDFHSNHKVFEITIQLGAVLAVVFEYRQRFSNVLHGVGKDRKANRFVLNLAIAFIPAAVMGLLFGKQIKEYLFNPLSVAVMLVLGGFFILWVEKRQSRAEPKIVDVDALRPIDALMIGVAQVFALVPGTSRSGSTIMGGMLWGIERKTATEFSFFLAVPMMVAATAYDVLKHYRFFTLHDVGLILIGFVAAFVSGLVAVKALLRFVSKKNYIPFAYYRIVFGIAIIILWLSGWISWE",
"proteome": null,
"gene": "uppP",
"go_terms": [
{
"identifier": "GO:0050380",
"name": "undecaprenyl-diphosphatase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016311",
"name": "dephosphorylation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "6c468346ca4240d9926b124a0335c66cb0e2481a",
"counters": {
"domain_architectures": 29056,
"entries": 7,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ncbifam": 3,
"hamap": 1,
"panther": 1,
"pfam": 1,
"interpro": 1
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 29056
}
}
}