General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q9J548",
        "id": "A21_FOWPN",
        "source_organism": {
            "taxId": "928301",
            "scientificName": "Fowlpox virus (strain NVSL)",
            "fullName": "Fowlpox virus (strain NVSL) (FPV)"
        },
        "name": "Virion membrane protein A21 homolog",
        "description": [
            "Envelope protein part of the entry-fusion complex responsible for the virus membrane fusion with host cell membrane during virus entry"
        ],
        "length": 113,
        "sequence": "MFVLFLIVCYFILIFNIIVPKIADKLRLEHEAFTKYRQIYGNKFRCIGDNLINYSFTPFGVKANYLVNKNTKMPAICNDIKNINSLIAVTCDDASKFIKHRNICERAYTELFL",
        "proteome": "UP000008597",
        "gene": "FPV186",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "255e7bb63ab561676c211f79346415f55527a115",
        "counters": {
            "domain_architectures": 128,
            "entries": 2,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 128
        }
    }
}