HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q9HS93",
"id": "GATB_HALSA",
"source_organism": {
"taxId": "64091",
"scientificName": "Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)",
"fullName": "Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)"
},
"name": "Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B",
"description": [
"Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln)"
],
"length": 495,
"sequence": "MSAQAAERDLTAIIGLEVHVQLETDTKIFCGCSTDTDDADPNTHTCPVCLGLPGALPTLNEGAVEAAVKLGKAIDADIPERTRFHRKNYFYPDLPKGFQITQYDAPICQDGELEVGTADDRRAIGIERAHLEEDPGSLQHVGGSIEDADYTLVDYNRAGTPLMEIVTRPDFRAAEEVRSFLAKLTSVLEYLGVFDAERDGSLRVDANISMVDSAELAGEGGPSDDVLEAANRTEVKNISSHRAAQKALAYETTRQRNQLERGMAVAQETRHWDEARGVTVSMRSKEEEKDYRYFREADIPPLEVSDWKDEIPIPELPDARRERFRTEYGVGDETASKLTSRKAVADLFEELADEYDAALAATWVADNVLGELNYRDLSLDDVADRDDEFERLVELVAEDEITAKNAEEVVLRTMLDEDRAPDEIVDAEGLGKTSGDAVADAVAEAIAENPDAVADYHDGEGDALNFLVGQVMAKTGGSADPGQVNELLRDELAQA",
"proteome": "UP000000554",
"gene": "gatB",
"go_terms": [
{
"identifier": "GO:0003824",
"name": "catalytic activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016874",
"name": "ligase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016884",
"name": "carbon-nitrogen ligase activity, with glutamine as amido-N-donor",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "320ed30c9beaffdacfe991878650c6fe77022603",
"counters": {
"domain_architectures": 25767,
"entries": 22,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 2,
"pfam": 2,
"cathgene3d": 2,
"smart": 1,
"panther": 1,
"hamap": 1,
"ncbifam": 3,
"prosite": 1,
"interpro": 9
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 25767
}
}
}