HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q9GS40",
"id": "Q9GS40_DROHE",
"source_organism": {
"taxId": "32382",
"scientificName": "Drosophila heteroneura",
"fullName": "Drosophila heteroneura (Fruit fly)"
},
"name": "Glycerol-3-phosphate dehydrogenase [NAD(+)]",
"description": null,
"length": 248,
"sequence": "KNADILIFVVPHQFIPNFCKQLLGKIKPSAIAISLIKGFDKAEGGGIDLISHIITRHLKIPCAVLMGANLANEVAEGNFCETTIGCTDKKYGKVLRDLFQANHFRVVVVGDADAVEVCGALKNIVACGAGFVDGLKLGDNTKAAVIRLGLMEMIRFVDVFYPGSKLSTFFESCGVADLITTCYGGRNRRVSEAFVTSGKTIEELEKEMLNGQKLQGPPTAEEVNYMLKNKGLEDKFPLFTGIHKICTN",
"proteome": null,
"gene": "Gpdh",
"go_terms": [
{
"identifier": "GO:0005975",
"name": "carbohydrate metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0006072",
"name": "glycerol-3-phosphate metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016616",
"name": "oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0051287",
"name": "NAD binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0046168",
"name": "glycerol-3-phosphate catabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0042803",
"name": "protein homodimerization activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "46cafe0a4d005ca4997d310406050087410e4ba4",
"counters": {
"domain_architectures": 35267,
"entries": 17,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 2,
"pfam": 2,
"ncbifam": 1,
"panther": 1,
"prints": 1,
"prosite": 1,
"interpro": 7
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 35267
}
}
}