General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q9G921",
        "id": "Q9G921_OCHDN",
        "source_organism": {
            "taxId": "2986",
            "scientificName": "Ochromonas danica",
            "fullName": "Ochromonas danica (Golden alga)"
        },
        "name": "NADH-quinone oxidoreductase subunit D domain-containing protein",
        "description": [
            "Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Component of the iron-sulfur (IP) fragment of the enzyme. Component of the iron-sulfur (IP) fragment of the enzyme"
        ],
        "length": 398,
        "sequence": "MKIKKKDLNIELKNFTINFGPQHPAAHGVLRLILELDGEVVEKADPHIGLLHRGTEKLIEFKTYLQALPYFDRLDYVSMMAQEHTYSLAIEKIGNIVIPERAKIIRTIFAEITRLLNHLLAVGCHAMDVGAMTPFLWAFEEREKLMEFYERVSGARMHAAYIRPGGVSMDIPLGLLDDLYIFVNQFNYRLDEMEEMLTKSRIWKERLVDIGVVSAAKAIEWGFSGVMLRGSGISWDLRKNQPYEIYSEIDFSIPVGNSGDCYDRYLVRVEEMRQSIYIISKCLTKIKEGPIKSNNYKISPPSRLEMKNSMEAVIHHFKYFSEGFVLPCGETYTSTEAPKGEFGVYLVSNNTEKPYRCKIKAPGFGHLQALNDMSKGHLIADVVTIIGTQDIVFGEIDR",
        "proteome": null,
        "gene": "nad7",
        "go_terms": [
            {
                "identifier": "GO:0016651",
                "name": "oxidoreductase activity, acting on NAD(P)H",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0048038",
                "name": "quinone binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051287",
                "name": "NAD binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "10402606fa10b66bf9d99416e3ef252c18ea9acd",
        "counters": {
            "domain_architectures": 33063,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "hamap": 1,
                "panther": 1,
                "ncbifam": 2,
                "pfam": 1,
                "prosite": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 33063
        }
    }
}