GET /api/protein/UniProt/Q9F7L6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q9F7L6",
        "id": "ILVC_PRB01",
        "source_organism": {
            "taxId": "133804",
            "scientificName": "Gamma-proteobacterium EBAC31A08",
            "fullName": "Gamma-proteobacterium EBAC31A08"
        },
        "name": "Ketol-acid reductoisomerase (NADP(+))",
        "description": [
            "Involved in the biosynthesis of branched-chain amino acids (BCAA). Catalyzes an alkyl-migration followed by a ketol-acid reduction of (S)-2-acetolactate (S2AL) to yield (R)-2,3-dihydroxy-isovalerate. In the isomerase reaction, S2AL is rearranged via a Mg-dependent methyl migration to produce 3-hydroxy-3-methyl-2-ketobutyrate (HMKB). In the reductase reaction, this 2-ketoacid undergoes a metal-dependent reduction by NADPH to yield (R)-2,3-dihydroxy-isovalerate"
        ],
        "length": 347,
        "sequence": "MKIYYDEDANIEIIKGMNVSIIGYGSQGNAHANNLHESGVSVTVGLREGSSSWAKAEEAGLKVQTVADSVIQADLVMILAPDEFQKNIYETEIKPNLKTSAILAFAHGFNIHFEKIVPEATNSVIMIAPKGPGHTVRSTYTNGGGVPSLIAIYEDALSDEDYSAKDVALSYAKANGGTRAGVLETSFKEETETDLFGEQAVLCGGLTALIKAGFETLVEAGYSEEMAYFECLHETKLITDLIQEGGIANMHYSISNTAEYGDYVSGPKVITSDTKKAMKGILENIQSGKFADDFLNDCRQSNDGTGGPVMKSNREATKIHPIESVGAELRSKMKFLNSQKLVDKEIN",
        "proteome": null,
        "gene": "ilvC",
        "go_terms": [
            {
                "identifier": "GO:0004455",
                "name": "ketol-acid reductoisomerase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009082",
                "name": "branched-chain amino acid biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016491",
                "name": "oxidoreductase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0050661",
                "name": "NADP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "23be5c984df3ce0fb023b39c00f37e3a52a70888",
        "counters": {
            "domain_architectures": 21735,
            "entries": 19,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 2,
                "cathgene3d": 2,
                "ssf": 2,
                "pfam": 2,
                "hamap": 1,
                "ncbifam": 2,
                "panther": 1,
                "pirsf": 1,
                "interpro": 6
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 21735
        }
    }
}