General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q9D9J3",
        "id": "ACTT1_MOUSE",
        "source_organism": {
            "taxId": "10090",
            "scientificName": "Mus musculus",
            "fullName": "Mus musculus (Mouse)"
        },
        "name": "Actin-related protein T1",
        "description": [
            "Negatively regulates the Hedgehog (SHH) signaling. Binds to the promoter of the SHH signaling mediator, GLI1, and inhibits its expression"
        ],
        "length": 376,
        "sequence": "MLDPARLDNPAVIFDNGSGLCKVGISGEIEPRHVINSVVGHPKFNIPSARSNRKRYFVGEEAQCMYDGLYLHYPIERGLVTRWDDMEKLWKDLFEWELGVKPNEQPVFMTEPSLNPQETREKTTEIMFEKFNVPALYLCNHAVGALCASACITGLVLDSGDGVTCTVPVYEGYSLPHAITKLYVAGRDITEHLTRLLLAKGYTFPCILNKAVVDDIKEKLCTVSLGYKDTEKNCQQFLRKYTLPDGNTIQMSDHLCQVPEVLFTPDHLGIHDLGISKMVCNSIMNCDTDIQENLFAEIVLSGGTTMFPGLQDRLLKELEDLAFEGTPIKITASSDRCYSAWIGGSVMTSMTTFKQMWVTAEDFKEYGAFVVQRKCF",
        "proteome": "UP000000589",
        "gene": "Actrt1",
        "go_terms": null,
        "protein_evidence": 2,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "7c3fd5f9f93389082cb00e4f32e34df39e168dec",
        "counters": {
            "domain_architectures": 86462,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "smart": 1,
                "cdd": 1,
                "cathgene3d": 2,
                "pfam": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 86462
        }
    }
}