General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q9D9I1",
        "id": "SMI10_MOUSE",
        "source_organism": {
            "taxId": "10090",
            "scientificName": "Mus musculus",
            "fullName": "Mus musculus (Mouse)"
        },
        "name": "Sperm-associated microtubule inner protein 10",
        "description": [
            "Microtubule inner protein (MIP) part of the dynein-decorated doublet microtubules (DMTs) in flagellum axoneme, which is required for flagellum beating (PubMed:34446558, PubMed:37295417, PubMed:37989994). May serve to reinforce and thus stabilize the microtubule structure in the sperm flagella (PubMed:34446558, PubMed:37295417). Involved in the regulation of sperm motility (PubMed:34446558)"
        ],
        "length": 141,
        "sequence": "MASEKDDGPALPKLDDDNQTAENTCKPAEEQPQQLRWDDIHLPRFSLKQGMIPTRYVMPWKENMKFRNVNLQQAEACGIYAGPLEDSLFWGYSERLCHGEDRKAVLKKGLPEIKITDMPLHSPLSRYQSTVISHGFRRRLI",
        "proteome": "UP000000589",
        "gene": "Spmip10",
        "go_terms": null,
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "17ac6bb5d845c7b0a732b8c918b9fca6e90dc0f6",
        "counters": {
            "domain_architectures": 357,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 3,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "panther": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 357
        }
    }
}