General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q9CQL1",
        "id": "MGN2_MOUSE",
        "source_organism": {
            "taxId": "10090",
            "scientificName": "Mus musculus",
            "fullName": "Mus musculus (Mouse)"
        },
        "name": "Protein mago nashi homolog 2",
        "description": [
            "Required for pre-mRNA splicing as component of the spliceosome. Plays a redundant role with MAGOH in the exon junction complex and in the nonsense-mediated decay (NMD) pathway"
        ],
        "length": 146,
        "sequence": "MGSDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYLVQDLKCLVFSLIGLHFKIKPI",
        "proteome": "UP000000589",
        "gene": "Magohb",
        "go_terms": [
            {
                "identifier": "GO:0005634",
                "name": "nucleus",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0008380",
                "name": "RNA splicing",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0035145",
                "name": "exon-exon junction complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "3f12675fb5d4fcaa42ea013663b79d691ee96516",
        "counters": {
            "domain_architectures": 4764,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "cdd": 1,
                "ssf": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4764
        }
    }
}