General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q9CN24",
        "id": "MOAE_PASMU",
        "source_organism": {
            "taxId": "272843",
            "scientificName": "Pasteurella multocida (strain Pm70)",
            "fullName": "Pasteurella multocida (strain Pm70)"
        },
        "name": "Molybdopterin synthase catalytic subunit",
        "description": [
            "Converts molybdopterin precursor Z into molybdopterin. This requires the incorporation of two sulfur atoms into precursor Z to generate a dithiolene group. The sulfur is provided by MoaD (By similarity)"
        ],
        "length": 150,
        "sequence": "MSDIQIAVQEQPFDQNAAYRWLSEQHSVGATVVFVGKVRDLNLGDEVSSLYLEHYPAMTEKALTEIVAQAKARWDIQRVCVIHRVGLLQTGDEIVFVGVSSAHRGEAYQANEFIMDFLKSKAPFWKKEKTTQGERWIESRDTDQQALARW",
        "proteome": "UP000000809",
        "gene": "moaE",
        "go_terms": [
            {
                "identifier": "GO:0006777",
                "name": "Mo-molybdopterin cofactor biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "7f26b4bd64731bfa3b72046b085fc9409bd2447d",
        "counters": {
            "domain_architectures": 21975,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "ncbifam": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 21975
        }
    }
}