General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q9CHV6",
        "id": "Q9CHV6_LACLA",
        "source_organism": {
            "taxId": "272623",
            "scientificName": "Lactococcus lactis subsp. lactis (strain IL1403)",
            "fullName": "Lactococcus lactis subsp. lactis (strain IL1403)"
        },
        "name": "Methionine aminopeptidase",
        "description": [
            "Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed"
        ],
        "length": 284,
        "sequence": "MITLKSQREIEQMERSSKILADIHIGLRELIKPGIDMWEIEEYVRKVCKEKNVLPLQIGVDEGNYNPFPYATCCCLNDEVAHAFPRHQILKDGDLIKVDMVLGLVEDGSVDVSKLNFDDAESMVKYQEEFRGGVADSCWAYAVGQVSDEVKNLMDVTRECLYLGIEQAKVGNRIGDIGAAIQEYAESRGYGVVRDLVGHGVGPTMHEEPMVPHYGRAGRGLRLREGMVLTIEPMINTGGWEIDHDGERGYVTLDGSLSCQYEHQFVITKDGPVILTSQGEERTY",
        "proteome": "UP000002196",
        "gene": "pepM",
        "go_terms": [
            {
                "identifier": "GO:0070006",
                "name": "metalloaminopeptidase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006508",
                "name": "proteolysis",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "3d973ff0814c6f6eba53baa9200e03c921b0321a",
        "counters": {
            "domain_architectures": 808,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "cdd": 1,
                "pfam": 1,
                "ncbifam": 1,
                "panther": 1,
                "hamap": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 808
        }
    }
}