GET /api/protein/UniProt/Q9AQC6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q9AQC6",
        "id": "LEUC_BUCUL",
        "source_organism": {
            "taxId": "168386",
            "scientificName": "Buchnera aphidicola subsp. Uroleucon rurale",
            "fullName": "Buchnera aphidicola subsp. Uroleucon rurale"
        },
        "name": "3-isopropylmalate dehydratase large subunit",
        "description": [
            "Catalyzes the isomerization between 2-isopropylmalate and 3-isopropylmalate, via the formation of 2-isopropylmaleate"
        ],
        "length": 369,
        "sequence": "ASGLMARKQMEQLIKNCDEFNISLYDINNPNQGIVHVIAPEKGMTLPGMIIVCGDSHTSTHGAFGALSFGIGTSEVEHVLATQTLKQQRFKNMKIEIIGDVPQFVTAKDIILFVIGRLGSSGGTGYVIEFCGNVIKKMSMEERMTVCNMAIEMGAKSGIIAPDEITYSYLREKIYSPYGLFWKKSIDYWKTLKSDKDAFFDKCFTIDVSNLAPQVTRGTNPDQVTSINEKIPNYNKFHSIVQKNSAKSACKYMGLKEGTYLTDIFIDKVFIGSCTNARIEDLRSASTILKNRKIANNVKAIVVPGSGSVKQQAEMEGLDKIFINAGFEWRLPGCSMCLGMNNDRLNVGERCASHSNRNFEGRQGRGGRT",
        "proteome": null,
        "gene": "leuC",
        "go_terms": [
            {
                "identifier": "GO:0003861",
                "name": "3-isopropylmalate dehydratase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051539",
                "name": "4 iron, 4 sulfur cluster binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009098",
                "name": "L-leucine biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ce3c78f80741389221571f1d9f6d53581a100cec",
        "counters": {
            "domain_architectures": 30453,
            "entries": 18,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "cdd": 1,
                "ssf": 1,
                "ncbifam": 3,
                "panther": 1,
                "pfam": 1,
                "prosite": 2,
                "prints": 1,
                "interpro": 7
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 30453
        }
    }
}