HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q9AQC6",
"id": "LEUC_BUCUL",
"source_organism": {
"taxId": "168386",
"scientificName": "Buchnera aphidicola subsp. Uroleucon rurale",
"fullName": "Buchnera aphidicola subsp. Uroleucon rurale"
},
"name": "3-isopropylmalate dehydratase large subunit",
"description": [
"Catalyzes the isomerization between 2-isopropylmalate and 3-isopropylmalate, via the formation of 2-isopropylmaleate"
],
"length": 369,
"sequence": "ASGLMARKQMEQLIKNCDEFNISLYDINNPNQGIVHVIAPEKGMTLPGMIIVCGDSHTSTHGAFGALSFGIGTSEVEHVLATQTLKQQRFKNMKIEIIGDVPQFVTAKDIILFVIGRLGSSGGTGYVIEFCGNVIKKMSMEERMTVCNMAIEMGAKSGIIAPDEITYSYLREKIYSPYGLFWKKSIDYWKTLKSDKDAFFDKCFTIDVSNLAPQVTRGTNPDQVTSINEKIPNYNKFHSIVQKNSAKSACKYMGLKEGTYLTDIFIDKVFIGSCTNARIEDLRSASTILKNRKIANNVKAIVVPGSGSVKQQAEMEGLDKIFINAGFEWRLPGCSMCLGMNNDRLNVGERCASHSNRNFEGRQGRGGRT",
"proteome": null,
"gene": "leuC",
"go_terms": [
{
"identifier": "GO:0003861",
"name": "3-isopropylmalate dehydratase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0051539",
"name": "4 iron, 4 sulfur cluster binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009098",
"name": "L-leucine biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "ce3c78f80741389221571f1d9f6d53581a100cec",
"counters": {
"domain_architectures": 30453,
"entries": 18,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"cdd": 1,
"ssf": 1,
"ncbifam": 3,
"panther": 1,
"pfam": 1,
"prosite": 2,
"prints": 1,
"interpro": 7
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 30453
}
}
}