GET /api/protein/UniProt/Q9ANR7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q9ANR7",
        "id": "TYSY_BACMO",
        "source_organism": {
            "taxId": "72360",
            "scientificName": "Bacillus mojavensis",
            "fullName": "Bacillus mojavensis"
        },
        "name": "Thymidylate synthase",
        "description": [
            "Catalyzes the reductive methylation of 2'-deoxyuridine-5'-monophosphate (dUMP) to 2'-deoxythymidine-5'-monophosphate (dTMP) while utilizing 5,10-methylenetetrahydrofolate (mTHF) as the methyl donor and reductant in the reaction, yielding dihydrofolate (DHF) as a by-product. This enzymatic reaction provides an intracellular de novo source of dTMP, an essential precursor for DNA biosynthesis"
        ],
        "length": 279,
        "sequence": "MTQFDKQYNSIIKEIIKNGISDEEFDVRTKWESDGTPAHTLSIITKQMRFDNSEVPILTTKKVAWKTAIKELLWIWQLKSNDVTELNKMGVHIWDQWKQEDGSIGHAYGFQLAKKNRNLNGEKVDQVDYLLHQLKNNPSSRRHITMLWNPDELDSMALTPCVYETQWYVKQGKLHLEVRARSNDMALGNPFNVFQYNVLQRMIAQVTGYELGEYIFNIGDCHVYTRHIDNLKIQMEREQFEAPKLWINPEVKDFYDFTIDDFKLINYKHGDRLSFEVAV",
        "proteome": null,
        "gene": "thyA",
        "go_terms": [
            {
                "identifier": "GO:0016741",
                "name": "transferase activity, transferring one-carbon groups",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004799",
                "name": "thymidylate synthase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006231",
                "name": "dTMP biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "6571d43d0db3476d3b47929b03c39208d2a83a8a",
        "counters": {
            "domain_architectures": 27171,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "cdd": 1,
                "ncbifam": 2,
                "panther": 1,
                "hamap": 1,
                "prints": 1,
                "prosite": 1,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 27171
        }
    }
}