General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q9AED6",
        "id": "Q9AED6_LEGPN",
        "source_organism": {
            "taxId": "446",
            "scientificName": "Legionella pneumophila",
            "fullName": "Legionella pneumophila"
        },
        "name": "Sec-independent protein translocase protein TatC",
        "description": [
            "Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. Together with TatB, TatC is part of a receptor directly interacting with Tat signal peptides"
        ],
        "length": 238,
        "sequence": "MLIHLIELRQRAIYTLLWFGALALLFFFISDQLFHLLVKPLLRSLPNQEGLIATQITSSVFTPLKLAVDTALLLTAPFALLQLWRFMRPGLYKNEQEQIRGTIILSLLLFVFGALFCFYLVLPYMFQFFAQALPEGVRLMPDMAYAIDFITRMLLLFGFSFQVPLICLVLVKTHFTTVETLIKIRPYVIVGAFIIGMLLTPPDVFSQVALALPLCLLYEAGIILARIYGKSPMPTLIQ",
        "proteome": null,
        "gene": "tatC",
        "go_terms": [
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ec8a065fbf701ee1a65f7fd9d4ef3fdf14e4eec5",
        "counters": {
            "domain_architectures": 26326,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "hamap": 1,
                "ncbifam": 1,
                "pfam": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 1
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 26326
        }
    }
}