GET /api/protein/UniProt/Q9A894/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q9A894",
"id": "SSB_CAUVC",
"source_organism": {
"taxId": "190650",
"scientificName": "Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)",
"fullName": "Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)"
},
"name": "Single-stranded DNA-binding protein",
"description": [
"Plays an important role in DNA replication, recombination and repair. Binds to ssDNA and to an array of partner proteins to recruit them to their sites of action during DNA metabolism"
],
"length": 167,
"sequence": "MAGSVNKVILVGNLGADPEIRSLGSGDRVANLRIATSETWRDRSSGERKEKTEWHRVVIFNDNLVKVAEQYLRKGSTVYIEGALQTRKWTDNTGQEKYSTEIVLQKFRGELTMLGGRGGDAGMSSGGGDEYGGGYSGGGSSFGGGQRSQPSGPRESFSADLDDEIPF",
"proteome": "UP000001816",
"gene": "ssb",
"go_terms": [
{
"identifier": "GO:0003697",
"name": "single-stranded DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006260",
"name": "DNA replication",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "f1fb2be8363e3a291867f69be613915a57077a1b",
"counters": {
"domain_architectures": 57966,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"profile": 1,
"cdd": 1,
"panther": 1,
"ncbifam": 1,
"hamap": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 57966
}
}
}