HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q99MI5",
"id": "Q99MI5_RAT",
"source_organism": {
"taxId": "10116",
"scientificName": "Rattus norvegicus",
"fullName": "Rattus norvegicus (Rat)"
},
"name": "Spermidine synthase",
"description": [
"Catalyzes the production of spermidine from putrescine and decarboxylated S-adenosylmethionine (dcSAM). Has a strong preference for putrescine as substrate, and has very low activity towards 1,3-diaminopropane. Has extremely low activity towards spermidine"
],
"length": 302,
"sequence": "MEPGPDGPAAPGPAAIREGWFRETCSLWPGQALSLQVEQLLHHRRSRYQDILVFRSKTYGNVLVLDGVIQCTERDEFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIEVSKKFLPGMAVGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKTALKEDGILCCQGECQWLHLDLIKEMRHFCKSLFPVVSYAYCTIPTYPSGQIGFMLCSKNPSTNFREPVQQLTQAQVEQMQLKYYNSDMHRAAFVLPEFTRKALNDIS",
"proteome": "UP000002494",
"gene": "Srm",
"go_terms": [
{
"identifier": "GO:0006595",
"name": "polyamine metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0003824",
"name": "catalytic activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 1,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "090b752ef5f88e1716cd205da090ef795e2a8e15",
"counters": {
"domain_architectures": 14482,
"entries": 20,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 1,
"profile": 1,
"pfam": 2,
"cdd": 1,
"pirsf": 1,
"panther": 1,
"ncbifam": 2,
"hamap": 1,
"prosite": 1,
"interpro": 7
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 14482
}
}
}