General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q96UR9",
        "id": "AOX_MONFR",
        "source_organism": {
            "taxId": "38448",
            "scientificName": "Monilinia fructicola",
            "fullName": "Monilinia fructicola (Brown rot fungus)"
        },
        "name": "Alternative oxidase, mitochondrial",
        "description": [
            "Catalyzes cyanide-resistant oxygen consumption. May increase respiration when the cytochrome respiratory pathway is restricted, or in response to low temperatures (By similarity)"
        ],
        "length": 358,
        "sequence": "MYVARLSTRPLSNPSTAQLSKAAAFFAQSYALPSTKCTAHVPSRRPFTSGAKIQVKGRDLFPEPXHGQIKRTEPAWPHPPYSVEQMRSKVYFAHRKPRDFSDRVALGMVRFLRWCTDFATGYKHNVEAPKTASDSNAVTATKPYQMSERKWLIRYVFLESVAGVPGMVAGMLRHLRSLRGLKRDNGWIETLLEEAYNERMHLLTFLKMYEPGLFMRTMILGAQGVFFNSFFLCYLFSPKTCHRFVGYLEEEAVLTYTLSIQDLENGHLPKWADPNFKAPDLAIEYWGMPEGHRSMRDLLYYIRADEAKHREVNHTLGNLKQDEDPNPFVSVYGKEVADKPGKGIESLRPLGWEREEVI",
        "proteome": null,
        "gene": "AOX1",
        "go_terms": [
            {
                "identifier": "GO:0009916",
                "name": "alternative oxidase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "932d009ae651ec247a9ec11a6fc7b3095f5d09ea",
        "counters": {
            "domain_architectures": 6325,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 1,
                "cdd": 1,
                "pirsf": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 6325
        }
    }
}