General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q95US5",
        "id": "BRE5_CAEEL",
        "source_organism": {
            "taxId": "6239",
            "scientificName": "Caenorhabditis elegans",
            "fullName": "Caenorhabditis elegans"
        },
        "name": "Beta-1,3-galactosyltransferase bre-5",
        "description": [
            "Transfers N-acetylgalactosamine onto mannose groups of carbohydrate substrates. Required for susceptibility to pore-forming crystal toxins in conjunction with bre-1, bre-2, bre-3, and bre-4. Involved in resistance to the nematotoxic C.cinerea galectin Cgl2 (PubMed:20062796)"
        ],
        "length": 322,
        "sequence": "MFLCVRILKRKYHELSSFQKLLIFTITIFLLWVLGVVDKFRETSFGDFSWPLETRNLQLRSKFTKYPQCKFSGNGQKIIIIIIKSSAKNGPMRESVRKTWGVFRMIDGVEVMPIFIVGRVENMEIMRRIDVESEKYKDILAISDIDSYRNNTLKLFGAIDYAANPNQCSSPDFTFLVDDDYLVHIPNLVKFAKTKQKEELVYEGFVFDTSPFRLKIHKHSISLNEYPFSRYPPYVSAGAVFLTSETIARFRNSIRKLKMFPFDDVFTGILAKTVNVAATHNENFIFWCRRVSQKEWDDGVIAVHGYARKDLEYEYSQLNGFE",
        "proteome": "UP000001940",
        "gene": "bre-5",
        "go_terms": [
            {
                "identifier": "GO:0016758",
                "name": "hexosyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009101",
                "name": "glycoprotein biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ad501d98169c72b7fb1ce175efd5c4d3c278e4fd",
        "counters": {
            "domain_architectures": 27846,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 27846
        }
    }
}