HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q95GN7",
"id": "IF1C_ILLPA",
"source_organism": {
"taxId": "13099",
"scientificName": "Illicium parviflorum",
"fullName": "Illicium parviflorum (Yellow anise tree)"
},
"name": "Translation initiation factor IF-1, chloroplastic",
"description": [
"One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex"
],
"length": 80,
"sequence": "MKEQKWIHEGLITESLPNGMFRVRLDNVDNEDLILGYVSGRIRRSFIRILPGXRVKIEVSRXDSTRGRIIYRLRNKDSNB",
"proteome": null,
"gene": "infA",
"go_terms": [
{
"identifier": "GO:0003723",
"name": "RNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003743",
"name": "translation initiation factor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006413",
"name": "translational initiation",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": false,
"in_bfvd": false,
"ida_accession": "70f1d1b0829b437c03f5cbd338266a2d7b9aebd0",
"counters": {
"domain_architectures": 44381,
"entries": 10,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"profile": 1,
"cathgene3d": 1,
"pfam": 1,
"hamap": 1,
"ncbifam": 1,
"panther": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 44381
}
}
}