GET /api/protein/UniProt/Q95GN7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q95GN7",
        "id": "IF1C_ILLPA",
        "source_organism": {
            "taxId": "13099",
            "scientificName": "Illicium parviflorum",
            "fullName": "Illicium parviflorum (Yellow anise tree)"
        },
        "name": "Translation initiation factor IF-1, chloroplastic",
        "description": [
            "One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex"
        ],
        "length": 80,
        "sequence": "MKEQKWIHEGLITESLPNGMFRVRLDNVDNEDLILGYVSGRIRRSFIRILPGXRVKIEVSRXDSTRGRIIYRLRNKDSNB",
        "proteome": null,
        "gene": "infA",
        "go_terms": [
            {
                "identifier": "GO:0003723",
                "name": "RNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003743",
                "name": "translation initiation factor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006413",
                "name": "translational initiation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "70f1d1b0829b437c03f5cbd338266a2d7b9aebd0",
        "counters": {
            "domain_architectures": 44381,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "profile": 1,
                "cathgene3d": 1,
                "pfam": 1,
                "hamap": 1,
                "ncbifam": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 44381
        }
    }
}