General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q93WE4",
        "id": "SINA6_ARATH",
        "source_organism": {
            "taxId": "3702",
            "scientificName": "Arabidopsis thaliana",
            "fullName": "Arabidopsis thaliana (Mouse-ear cress)"
        },
        "name": "Probable inactive E3 ubiquitin-protein ligase SINAT6",
        "description": [
            "Probable inactive E3 ubiquitin-protein ligase that plays a role in regulation of autophagy. Upon starvation, involved in maintaining ATG6 homeostasis by competitively associating with ATG6, a component of the autophagosome complex (PubMed:28351989). Acts as a positive regulator of drought stress response. Functions as a positive regulator of abscisic acid-mediated stomatal closure (PubMed:24350984)"
        ],
        "length": 216,
        "sequence": "MEPRINDLQVESRVHELLDFPVHTNQISSAIYECPNDHIENPKKKPYNCPHSGAKCDVTGDIQRLLLHLRNDHNVEMSDGRSFSHRYVHHDPKHLHHATWMLTLLDCCGRKFCLYFEAFHLRKTPMYMAFMQFMGDEEEAMSFSYSLQVGGNGRKLTWQGVPRSIRDSHKTVRDSQDGLIITRKLALFFSTDNNTTDKELKLKVSGRVWREQPVSI",
        "proteome": "UP000006548",
        "gene": "SINAT6",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006511",
                "name": "ubiquitin-dependent protein catabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0007275",
                "name": "multicellular organism development",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005737",
                "name": "cytoplasm",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "9c44eb04f9774a159b2dad5602859822b8e9906d",
        "counters": {
            "domain_architectures": 996,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 2,
                "ssf": 1,
                "cathgene3d": 2,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 996
        }
    }
}