General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q91T40",
        "id": "LAP_LSDV",
        "source_organism": {
            "taxId": "59509",
            "scientificName": "Lumpy skin disease virus",
            "fullName": "Lumpy skin disease virus (LSDV)"
        },
        "name": "E3 ubiquitin-protein ligase LAP",
        "description": [
            "E3 ubiquitin-protein ligase which promotes ubiquitination and subsequent degradation of host MHC-I and CD4 molecules, presumably to prevent lysis of infected cells by cytotoxic T-lymphocytes and NK cell. Binds target molecules through transmembrane interaction. The result of this ubiquitination is the enhancement of the endocytosis of the target chain and the delivery to the lysosome, where it is proteolytically destroyed (By similarity)"
        ],
        "length": 162,
        "sequence": "MEGSDNTNTHCWICKDEYNVSTNFCNCKNEFKIVHKNCLEEWINFSHNTKCKICNGKYNIKKNKKSCLRWKCSFMYCNVPAICVSLICLLLLPLTILLVKFNLKSMLENIENRDLIALISAMAYSLPCVVGFITVVHILIALYDYYLAAKSDNTTYQVYEYI",
        "proteome": null,
        "gene": "LW010",
        "go_terms": [
            {
                "identifier": "GO:0008270",
                "name": "zinc ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "8bf2bfef483bdf06a92e8e46fc0070a14fb9f871",
        "counters": {
            "domain_architectures": 28235,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "profile": 1,
                "ssf": 1,
                "smart": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 28235
        }
    }
}