General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q91821",
        "id": "MELK_XENLA",
        "source_organism": {
            "taxId": "8355",
            "scientificName": "Xenopus laevis",
            "fullName": "Xenopus laevis (African clawed frog)"
        },
        "name": "Maternal embryonic leucine zipper kinase",
        "description": [
            "Serine/threonine-protein kinase involved in various processes such as cell cycle regulation, self-renewal of stem cells, apoptosis and splicing regulation. Also plays a role in primitive hematopoiesis, possibly by affecting the expression of genes critical for hematopoiesis (By similarity). Plays a role in cytokinesis during early development"
        ],
        "length": 651,
        "sequence": "MAVDDYEELLKYYELHETVGTGGFAKVKLASHLITGEKVAIKIMDKESLGDDLPRVKTEIDAMKNLSHQHVCRLYHVIETPKKIFMVLEYCPGGELFDYIIAKDRLTEEEARVFFRQIVSAVAYIHSQGYAHRDLKPENLLIDEDQNLKLIDFGLCAKPKGGLDYHLMTCCGSPAYAAPELIQGKAYIGSEADIWSMGVLMYALMCGYLPFDDDNVMVLYKKIMRGKYEIPKWLSPGSVLLLSQMMQVDPKKRITVKHLLNHPWLMHGYSCPVEWQSKYPLGYIDEDCVTELSVFYKYSRTSTTRLISEWSYDHITASYLLLHSKKSHGKAVRLKHPLAVGDQAVTSFKELRPKSKLDFEEPNGEIAYVFGSMDFSDEELFSEDFTYSSFEPHTPKEYVKGRLEFNSVDSAPATPVVQRNARHKNEDKENSNTAVARDENVFLHPAPWTPTPRRKQNEKKGILTTPNKNTQTKEKNQSKETPTKKPIGTGEEFANVISPERRCRSVELDLNQAHIDSAQKKKGAKVFGSLERGLDKMITMLTPSKRKGYTREGPRKLRAHYNVTTTNIVNPEQLLNQIVRVLPSKNVDYVQKGYTLKCKTQSDFGKVTMQFELEVCQLSKSEVVGIRRQRLKGDAWVYKRLVEDILSSCKV",
        "proteome": "UP000186698",
        "gene": "melk",
        "go_terms": [
            {
                "identifier": "GO:0004674",
                "name": "protein serine/threonine kinase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006468",
                "name": "protein phosphorylation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0004672",
                "name": "protein kinase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005524",
                "name": "ATP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ecb589d8cbcf5008884e6bf1224620eb692442ce",
        "counters": {
            "domain_architectures": 1159,
            "entries": 24,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 6,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "cdd": 3,
                "ssf": 2,
                "pfam": 3,
                "profile": 2,
                "smart": 1,
                "panther": 1,
                "prosite": 2,
                "interpro": 8
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1159
        }
    }
}